PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015872527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 437aa    MW: 47973.5 Da    PI: 5.0162
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015872527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.82.7e-911504371295
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg..dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                     lv+ Ll+cAe ++ g+l+la +l+++++ l +       + ++a yf  AL++r++   ++ ++  ++      +  e+   ++ f+e+sP+lkf
  XP_015872527.1 150 LVHMLLTCAESIQRGELALAGSLIENMQALLTRVNtvCGIGKVAGYFIDALNRRVFA--PRGFANNSTY----GSAYENEVLYHHFYEASPYLKF 238
                     689***************************555541269*****************9..3333222222....235666778899********** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +h+taNqaIlea++g+++vH+iDf++++GlQWp+L+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g rLa++A++++v+f f+ ++a+rled
  XP_015872527.1 239 AHFTANQAILEAFDGHDCVHVIDFNLMHGLQWPPLIQALALRPGGPPLLRLTGIGPPSPDGHDSLREIGLRLAELAQSVNVRFAFRGVAASRLED 333
                     *********************************************************************************************** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++++L+v+p+Ea+aVn+++qlhrll  + + + +++ vL  +++l+Pk+++vveqeadhn+  Fl+rf+eal+yys++fdslea +    + ++
  XP_015872527.1 334 VKPWMLEVSPKEAVAVNSIMQLHRLLGANNTRNLPIEMVLGWIRNLNPKIMTVVEQEADHNQVGFLDRFTEALYYYSTMFDSLEACA---LQPAK 425
                     **************************99999999*************************************************9983...46666 PP

            GRAS 284 kvErellgreiv 295
                      + + +++rei+
  XP_015872527.1 426 ALAEIYIQREIC 437
                     677777888885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120412.1E-332894IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011296.4E-2528100No hitNo description
PROSITE profilePS5098550.108124437IPR005202Transcription factor GRAS
PfamPF035149.3E-89150437IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MGPYDSAISA GSSSGSSSSS TSKPHEIDGL LAGAGYKVRS SDLRQVAQRL ERLETVMVNS  60
PSDVSQLASD TVHYNPSDMA SWVDSLLSEL NNPHALPLPS DLPDFPDLIA SPVLNQTTMQ  120
NDDAWADPNI IPPHQLKVVT AMEEDSGIKL VHMLLTCAES IQRGELALAG SLIENMQALL  180
TRVNTVCGIG KVAGYFIDAL NRRVFAPRGF ANNSTYGSAY ENEVLYHHFY EASPYLKFAH  240
FTANQAILEA FDGHDCVHVI DFNLMHGLQW PPLIQALALR PGGPPLLRLT GIGPPSPDGH  300
DSLREIGLRL AELAQSVNVR FAFRGVAASR LEDVKPWMLE VSPKEAVAVN SIMQLHRLLG  360
ANNTRNLPIE MVLGWIRNLN PKIMTVVEQE ADHNQVGFLD RFTEALYYYS TMFDSLEACA  420
LQPAKALAEI YIQREIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3919141742270GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872527.10.0PREDICTED: DELLA protein DWARF8-like, partial
TrEMBLQ0HA680.0Q0HA68_MALDO; DELLA protein
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-99GRAS family protein